swanticker 100 Pieces of Cute Animal Stickers for Kids. Waterproof Vinyl Sticker - Aesthetic Sticker Bag for laptops, Water Bottles, Skateboards, Mobile Phones, Guitars, Teenagers, Boys and Girls
$7.99
Features
🦒 Cute water bottle stickers: Each package contains 100 animal stickers, including all major patterns, not random or repeated. Different combinations will give you different visual effects. This is an interesting experience. Cute stickers are the best gifts for kids.
🦒 High Quality Waterproof Sticker: The water bottle sticker is made of vinyl material. To ensure bright colors, the surface of the sticker is waterproof and sunscreen, safe and non-toxic, and the middle is high-definition printing technology, which can be torn off without residue.
🦒 Fashion decoration suitable for various styles: Animal stickers are unique and cute. Every child has his own imagination, so we designed a unique colorful cute animal sticker. Our beautiful and lovely stickers can be used to decorate water bottles, stationery boxes, skateboards, laptops, scrapbooks, parties, room decorations, etc.
🦒 Best DIY Kids Sticker Gifts: Our sea animal stickers are designed for all the kids who love stickers. The stickers are cute, vsco. You can give this scrapbook sticker to your child as a gift bag filler. Teachers and parents can reward students and children with super cute water bottle stickers to remind students and children to keep going to school. You can even share with everyone.
🦒 High quality after-sales service: customer satisfaction is our biggest driving force. We cooperate with Amazon FBA to provide you with the highest quality Amazon Prime transportation. If you have any questions about animal stickers, please feel free to contact us, and we will provide you with quality after-sales service.
Details
kgfrfudrevewybrgheupyurbeggs?kfurherhurSwker100PeesfuemSkersfrKds!Ehpkges100drbemskers,esurgyugevreyfdfferepersfredessusmzpssbes.hesewerprfvyskersreperfefrdergpps,werbes,skebrds,mbephes,gurs,dmre.eyurmgruwdwhheseuedvbrskershresurebrgsmeyhd'sfe.
skersrereedequ,whhswhyurhgh-quywerprfskersremdefrmdurbevymer.Whbrghrsdwerprf,susreesurfe,heseskersreysfed-xbusesyremvewhuevgyresdue.hehgh-defprgehgyesureshhedesgsrerspder,ddguhfhrmyurbeggshwsfrgme.
dduhffshdwhmsyyursyewhuruqueddrbemskers.heserfuskersreperfefrperszgwerbes,serybxes,pps,skebrds,srpbks,dmre.eyurrevyshewhhesefudverseskershresuremkesemewhereveryug.Wheheryu'reeeger,by,rgr,heseskersremus-hveessryexpressyurdvduy.
kgfrheperfegffrsker-vghd?urSwker100PeesfuemSkersfrKdsrehedehe!heseuedVs-spredskersmkegregfsfrbrhdys,hdys,rsmpyshwyurppre.ehersdpreseveusehemsrewrdsfrsudes,eurgghemexesh.Shrehejyfhesesuperueskerswheveryeyukwdspredhevefrevydfu.
usmerssfsurpprry,whhswhywefferhgh-quyfer-sesserveesureyuhvepesshppgexperee.PreredwhmzFB,weprvdefsdrebemzPrmeshppgdeveryurskersprmpy.fyuhveyquessrersbuurdrbemskers,d'heserehuus.Werehereprvdeyuwhexepfer-sessuppresureyurmpeessf.
Discover More Best Sellers in Stickers
Shop Stickers
$4.99
Stickers - Water Bottle Stickers for Kids, 200 Pcs Waterproof Vinyl Stickers for Water Bottles Stickers Pack for Kids Cute Stickers for School Students Laptop Kids Friendly (200 Pcs)
$9.99
Stickers - Sanrio Hello Kitty and Friends 1500+ Super Cute Kawaii Stickers, Hello Kitty Chococat My Melody Keroppi Badtz-Maru Pompompurin, Cute Gifts for Kids Teens Girls Adults
$9.99
Stickers - 1000PCS Halloween Stickers for Kids, 16 Designs Round Seal Stickers Label Roll Pumpkin Bat Witch Spider Stickers Halloween Character Party Favors Supplies Goodie Bag Scrapbook Decoration
$9.99
Stickers - Cute Snowman Face Stickers 32pcs Small Snowman Wall Decals Vinyl Snowman Faces Cup Stickers,Christmas Stickers for Snowman Face
$10.99
Stickers - PartyNow Animal Stickers | 24-Pack Make Your Own Stickers for Kids | Make a Face Sticker Sheets with Safari Animals | Mix and Match Kids Stickers | Fun Party Favors for Kids | Safari Party Supplies
$5.99
Stickers - Disney Stickers 100PCS Asverbet Kids Stickers Pack Princess Stickers Cute Stickers for Kids Teens Adults Waterproof Vinyl Cartoon Stickers for Water Bottles Laptop Luggage
$4.99
Stickers - My Cute Melody Stickers Pack 50Pcs, Cannity Cute Kawaii Stickers for Kids Teens Adults Waterproof Vinyl Decals Japanese Anime Stickers for Water Bottles Scrapbook Laptop journaling.
Shark Sticker 50Pcs Animal Cartoon Stickers for Water Cup Backpack Lovely Gift to Friends (Shark)
$4.99
Stickers - Shark Sticker 50Pcs Animal Cartoon Stickers for Water Cup Backpack Lovely Gift to Friends (Shark)


